PDB entry 1iyb

View 1iyb on RCSB PDB site
Description: Crystal Structure of the Nicotiana glutinosa Ribonuclease NW
Class: hydrolase
Keywords: hydrolase, ribonuclease
Deposited on 2002-08-05, released 2003-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.212
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Nicotiana glutinosa [TaxId:35889]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7XZV5 (4-207)
      • cloning artifact (0-3)
      • conflict (136)
    Domains in SCOPe 2.06: d1iyba1, d1iyba2
  • Chain 'B':
    Compound: Ribonuclease
    Species: Nicotiana glutinosa [TaxId:35889]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7XZV5 (4-207)
      • cloning artifact (0-3)
      • conflict (136)
    Domains in SCOPe 2.06: d1iybb1, d1iybb2
  • Heterogens: 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iybA (A:)
    yvefaqdfdffyfvqqwpgsycdtkqsccypktgkpasdfgihglwpnnndgsypsncds
    nspydqsqvsdlisrmqqnwptlacpsgtgsafwshewekhgtcaenvfdqhgyfkkald
    lknqinlleilqgagihpdggfyslnsiknairsaigyapgiecnvdesgnsqlyqiyic
    vdgsgsnliecpifprgkcgssiefptf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iybB (B:)
    yvefaqdfdffyfvqqwpgsycdtkqsccypktgkpasdfgihglwpnnndgsypsncds
    nspydqsqvsdlisrmqqnwptlacpsgtgsafwshewekhgtcaenvfdqhgyfkkald
    lknqinlleilqgagihpdggfyslnsiknairsaigyapgiecnvdesgnsqlyqiyic
    vdgsgsnliecpifprgkcgssiefptf