PDB entry 1iyb

View 1iyb on RCSB PDB site
Description: Crystal Structure of the Nicotiana glutinosa Ribonuclease NW
Deposited on 2002-08-05, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.212
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1iyba_
  • Chain 'B':
    Domains in SCOP 1.67: d1iybb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iybA (A:)
    yvefaqdfdffyfvqqwpgsycdtkqsccypktgkpasdfgihglwpnnndgsypsncds
    nspydqsqvsdlisrmqqnwptlacpsgtgsafwshewekhgtcaenvfdqhgyfkkald
    lknqinlleilqgagihpdggfyslnsiknairsaigyapgiecnvdesgnsqlyqiyic
    vdgsgsnliecpifprgkcgssiefptf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iybB (B:)
    yvefaqdfdffyfvqqwpgsycdtkqsccypktgkpasdfgihglwpnnndgsypsncds
    nspydqsqvsdlisrmqqnwptlacpsgtgsafwshewekhgtcaenvfdqhgyfkkald
    lknqinlleilqgagihpdggfyslnsiknairsaigyapgiecnvdesgnsqlyqiyic
    vdgsgsnliecpifprgkcgssiefptf