PDB entry 1iy9

View 1iy9 on RCSB PDB site
Description: Crystal structure of spermidine synthase
Class: transferase
Keywords: Rossmann fold, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSFERASE
Deposited on 2002-07-26, released 2002-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spermidine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iy9a_
  • Chain 'B':
    Compound: spermidine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iy9b_
  • Chain 'C':
    Compound: spermidine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iy9c_
  • Chain 'D':
    Compound: spermidine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iy9d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iy9A (A:)
    selwytekqtknfgitmkvnktlhteqtefqhlemveteefgnmlfldgmvmtsekdefv
    yhemvahvplfthpnpehvlvvgggdggvireilkhpsvkkatlvdidgkvieyskkflp
    siagklddprvdvqvddgfmhiaksenqydvimvdstepvgpavnlftkgfyagiakalk
    edgifvaqtdnpwftpelitnvqrdvkeifpitklytaniptypsglwtftigskkydpl
    avedsrffdietkyytkdihkaafvlpkfvsdlik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iy9A (A:)
    selwytekqtknfgitmkvnktlhteqtefqhlemveteefgnmlfldgmvmtsekdefv
    yhemvahvplfthpnpehvlvvgggdggvireilkhpsvkkatlvdidgkvieyskkflp
    siagklddprvdvqvddgfmhiaksenqydvimvdstepvgpavnlftkgfyagiakalk
    edgifvaqtdnpwftpelitnvqrdvkeifpitklytaniptypsglwtftigskkydpl
    avedsrffdietkyytkdihkaafvlpkfvsdli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iy9B (B:)
    selwytekqtknfgitmkvnktlhteqtefqhlemveteefgnmlfldgmvmtsekdefv
    yhemvahvplfthpnpehvlvvgggdggvireilkhpsvkkatlvdidgkvieyskkflp
    siagklddprvdvqvddgfmhiaksenqydvimvdstepvgpavnlftkgfyagiakalk
    edgifvaqtdnpwftpelitnvqrdvkeifpitklytaniptypsglwtftigskkydpl
    avedsrffdietkyytkdihkaafvlpkfvsdlik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iy9B (B:)
    selwytekqtknfgitmkvnktlhteqtefqhlemveteefgnmlfldgmvmtsekdefv
    yhemvahvplfthpnpehvlvvgggdggvireilkhpsvkkatlvdidgkvieyskkflp
    siagklddprvdvqvddgfmhiaksenqydvimvdstepvgpavnlftkgfyagiakalk
    edgifvaqtdnpwftpelitnvqrdvkeifpitklytaniptypsglwtftigskkydpl
    avedsrffdietkyytkdihkaafvlpkfvsdli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iy9C (C:)
    selwytekqtknfgitmkvnktlhteqtefqhlemveteefgnmlfldgmvmtsekdefv
    yhemvahvplfthpnpehvlvvgggdggvireilkhpsvkkatlvdidgkvieyskkflp
    siagklddprvdvqvddgfmhiaksenqydvimvdstepvgpavnlftkgfyagiakalk
    edgifvaqtdnpwftpelitnvqrdvkeifpitklytaniptypsglwtftigskkydpl
    avedsrffdietkyytkdihkaafvlpkfvsdlik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iy9C (C:)
    selwytekqtknfgitmkvnktlhteqtefqhlemveteefgnmlfldgmvmtsekdefv
    yhemvahvplfthpnpehvlvvgggdggvireilkhpsvkkatlvdidgkvieyskkflp
    siagklddprvdvqvddgfmhiaksenqydvimvdstepvgpavnlftkgfyagiakalk
    edgifvaqtdnpwftpelitnvqrdvkeifpitklytaniptypsglwtftigskkydpl
    avedsrffdietkyytkdihkaafvlpkfvsdli
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1iy9D (D:)
    selwytekqtknfgitmkvnktlhteqtefqhlemveteefgnmlfldgmvmtsekdefv
    yhemvahvplfthpnpehvlvvgggdggvireilkhpsvkkatlvdidgkvieyskkflp
    siagklddprvdvqvddgfmhiaksenqydvimvdstepvgpavnlftkgfyagiakalk
    edgifvaqtdnpwftpelitnvqrdvkeifpitklytaniptypsglwtftigskkydpl
    avedsrffdietkyytkdihkaafvlpkfvsdlik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iy9D (D:)
    selwytekqtknfgitmkvnktlhteqtefqhlemveteefgnmlfldgmvmtsekdefv
    yhemvahvplfthpnpehvlvvgggdggvireilkhpsvkkatlvdidgkvieyskkflp
    siagklddprvdvqvddgfmhiaksenqydvimvdstepvgpavnlftkgfyagiakalk
    edgifvaqtdnpwftpelitnvqrdvkeifpitklytaniptypsglwtftigskkydpl
    avedsrffdietkyytkdihkaafvlpkfvsdli