PDB entry 1iy6

View 1iy6 on RCSB PDB site
Description: Solution structure of OMSVP3 variant, P14C/N39C
Class: Hydrolase
Keywords: solution structure, CSH motif, NMR, OMSVP3, ovomucoid third domain, protease inhibitor, disulfide bond, variant, Hydrolase
Deposited on 2002-07-23, released 2003-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: omsvp3
    Species: Lophura nycthemera [TaxId:9046]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67954 (0-53)
      • engineered (11)
      • engineered (36)
    Domains in SCOPe 2.06: d1iy6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iy6A (A:)
    avsvdcseypkcactmeyrplcgsdnktygnkcnfccavvesngtltlshfgkc