PDB entry 1iy5

View 1iy5 on RCSB PDB site
Description: Solution structure of wild type OMSVP3
Class: hydrolase
Keywords: solution structure, CSH motif, NMR, OMSVP3, ovomucoid third domain, protease inhibitor, HYDROLASE
Deposited on 2002-07-23, released 2003-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: omsvp3
    Species: Lophura nycthemera [TaxId:9046]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1iy5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iy5A (A:)
    avsvdcseypkpactmeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc