PDB entry 1iy1

View 1iy1 on RCSB PDB site
Description:
Deposited on 2002-07-10, released 2002-11-06
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-06, with a file datestamp of 2002-11-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.207
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1iy1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iy1A (A:)
    kvtfkdvagaeeakeelkeiveflknpsrfhemgaripkgvllvgppgvgkthlaravag
    earvpfitasgsdfvemfvgvgaarvrdlfetakrhapcivfideidavgrkrgsgvggg
    ndereqtlnqllvemdgfekdtaivvmaatnrpdildpallrpgrfdrqiaidapdvkgr
    eqilrihargkplaedvdlallakrtpgfvgadlenllneaallaaregrrkitmkdlee
    aas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iy1A (A:)
    kvtfkdvagaeeakeelkeiveflknpsrfhemgaripkgvllvgppgvgkthlaravag
    earvpfitasgsdfvemfvgvgaarvrdlfetakrhapcivfideidavgrndereqtln
    qllvemdgfekdtaivvmaatnrpdildpallrpgrfdrqiaidapdvkgreqilrihar
    gkplaedvdlallakrtpgfvgadlenllneaallaaregrrkitmkdleeaas