PDB entry 1ixy

View 1ixy on RCSB PDB site
Description: Ternary complex of T4 phage BGT with UDP and a 13 mer DNA duplex
Class: transferase/DNA
Keywords: protein-dna complex, base-flipping, abasic site, TRANSFERASE/DNA COMPLEX
Deposited on 2002-07-09, released 2002-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA beta-glucosyltransferase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: BGT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ixya_
  • Chain 'B':
    Compound: DNA beta-glucosyltransferase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: BGT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ixyb_
  • Chain 'C':
    Compound: 5'-d(*gp*ap*tp*ap*cp*tp*3drp*ap*gp*ap*tp*ap*g)-3'
  • Chain 'D':
    Compound: 5'-d(*gp*ap*tp*ap*cp*tp*3drp*ap*gp*ap*tp*ap*g)-3'
  • Chain 'E':
    Compound: 5'-d(*cp*tp*ap*tp*cp*tp*gp*ap*gp*tp*ap*tp*c)-3'
  • Chain 'F':
    Compound: 5'-d(*cp*tp*ap*tp*cp*tp*gp*ap*gp*tp*ap*tp*c)-3'
  • Heterogens: MG, UDP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixyA (A:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
    yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
    tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
    nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
    nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixyB (B:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
    yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
    tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
    nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
    nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.