PDB entry 1ixx

View 1ixx on RCSB PDB site
Description: crystal structure of coagulation factors ix/x-binding protein (ix/x-bp) from venom of habu snake with a heterodimer of c-type lectin domains
Class: coagulation factor binding
Keywords: coagulation factor binding, c-type lectin, gla-domain binding, c-type crd motif, loop exchanged dimer
Deposited on 1997-05-01, released 1998-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.178
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulation factors ix/x-binding protein
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ixxa_
  • Chain 'B':
    Compound: coagulation factors ix/x-binding protein
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ixxb_
  • Chain 'C':
    Compound: coagulation factors ix/x-binding protein
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ixxc_
  • Chain 'D':
    Compound: coagulation factors ix/x-binding protein
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ixxd_
  • Chain 'E':
    Compound: coagulation factors ix/x-binding protein
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ixxe_
  • Chain 'F':
    Compound: coagulation factors ix/x-binding protein
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ixxf_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixxA (A:)
    dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk
    rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg
    qqnpfvcea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixxB (B:)
    dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
    hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
    fqa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixxC (C:)
    dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk
    rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg
    qqnpfvcea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixxD (D:)
    dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
    hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
    fqa
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixxE (E:)
    dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk
    rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg
    qqnpfvcea
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixxF (F:)
    dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
    hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
    fqa