PDB entry 1ixv

View 1ixv on RCSB PDB site
Description: Crystal Structure Analysis of homolog of oncoprotein gankyrin, an interactor of Rb and CDK4/6
Class: protein binding
Keywords: Ankyrin repeats, PROTEIN BINDING
Deposited on 2002-07-09, released 2003-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.194
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable 26S proteasome regulatory subunit p28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50086 (Start-227)
      • cloning artifact (228-230)
    Domains in SCOPe 2.07: d1ixva1, d1ixva2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ixvA (A:)
    msnyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskme
    nvnlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwf
    evsqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfh
    alaeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnvvda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ixvA (A:)
    nyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenv
    nlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfev
    sqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhal
    aeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnvvda