PDB entry 1ixs

View 1ixs on RCSB PDB site
Description: Structure of RuvB complexed with RuvA domain III
Class: Hydrolase
Keywords: heterodimeric protein complex, AAA-ATPase domain, complex with nucleotide, Hydrolase
Deposited on 2002-07-04, released 2002-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.231
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: holliday junction DNA helicase ruva
    Species: Thermus thermophilus [TaxId:274]
    Gene: ruvA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ixsa_
  • Chain 'B':
    Compound: ruvb
    Species: Thermus thermophilus [TaxId:274]
    Gene: RUVB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ixsb1, d1ixsb2
  • Heterogens: ANP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ixsA (A:)
    kvpphllagekveseaaeeavmalaalgfkeaqaravvldllaqnpkaraqdlikealkr
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ixsA (A:)
    eseaaeeavmalaalgfkeaqaravvldllaqnpkaraqdlikealkrlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ixsB (B:)
    medlalrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviah
    elgvnlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmd
    ivigqgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrd
    arllgvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalgl
    delglekrdreilevlilrfgggpvglatlatalsedpgtleevhepylirqgllkrtpr
    grvatelayrhlgypppv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ixsB (B:)
    lalrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelg
    vnlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivi
    gqgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarl
    lgvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalgldel
    glekrdreilevlilrfgggpvglatlatalsedpgtleevhepylirqgllkrtprgrv
    atelayrhlgypppv