PDB entry 1ixs

View 1ixs on RCSB PDB site
Description: Structure of RuvB complexed with RuvA domain III
Deposited on 2002-07-04, released 2002-11-06
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-06, with a file datestamp of 2002-11-06.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.231
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixsA (A:)
    eseaaeeavmalaalgfkeaqaravvldllaqnpkaraqdlikealkrlr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixsB (B:)
    lalrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelg
    vnlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivi
    gqgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarl
    lgvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalgldel
    glekrdreilevlilrfgggpvglatlatalsedpgtleevhepylirqgllkrtprgrv
    atelayrhlgypppv