PDB entry 1ixr

View 1ixr on RCSB PDB site
Description: RuvA-RuvB complex
Class: Hydrolase
Keywords: heterooligomeric complex, octameric RuvA, AAA-ATPase domain, complex with nucleotide, Hydrolase
Deposited on 2002-07-04, released 2002-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.268
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: holliday junction DNA helicase ruva
    Species: Thermus thermophilus [TaxId:274]
    Gene: ruvA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ixra1, d1ixra2
  • Chain 'B':
    Compound: holliday junction DNA helicase ruva
    Species: Thermus thermophilus [TaxId:274]
    Gene: ruvA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ixrb1, d1ixrb2, d1ixrb3
  • Chain 'C':
    Compound: ruvb
    Species: Thermus thermophilus [TaxId:274]
    Gene: RUVB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SL87 (Start-311)
      • engineered (308)
    Domains in SCOPe 2.07: d1ixrc1, d1ixrc2
  • Heterogens: ANP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ixrA (A:)
    mirylrglvlkkeaggfvllaggvgfflqaptpflqaleegkevgvhthlllkeeglsly
    gfpdeenlalfelllsvsgvgpkvalallsalpprllarallegdarlltsasgvgrrla
    erialelkgkvpphllagekveseaaeeavmalaalgfkeaqaravvldllaqnpkaraq
    dlikealkrlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ixrA (A:)
    mirylrglvlkkeaggfvllaggvgfflqaptpflqaleegkevgvhthlllkeeglsly
    gfpdeenlalfelllsvsgvgpkvalallsalpprllarallegdarlltsasgvgrrla
    erialelkgkvpphl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixrB (B:)
    mirylrglvlkkeaggfvllaggvgfflqaptpflqaleegkevgvhthlllkeeglsly
    gfpdeenlalfelllsvsgvgpkvalallsalpprllarallegdarlltsasgvgrrla
    erialelkgkvpphllagekveseaaeeavmalaalgfkeaqaravvldllaqnpkaraq
    dlikealkrlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ixrC (C:)
    medlalrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviah
    elgvnlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmd
    ivigqgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrd
    arllgvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalgl
    delglekrdreilevlilrfgggpvglatlatalsedpgtleevhepylirqgllkrtpr
    grvatelarrhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ixrC (C:)
    alrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelgv
    nlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivig
    qgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarll
    gvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalgldelg
    lekrdreilevlilrfgggpvglatlatalsedpgtleevhepylirqgllkrtprgrva
    telarrhl