PDB entry 1ixm

View 1ixm on RCSB PDB site
Description: crystal structure of spoob from bacillus subtilis
Class: transferase
Keywords: phosphotransferase, sporulation response regulator, two component system, regulatory protein
Deposited on 1998-11-06, released 1998-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (sporulation response regulatory protein)
    Species: Bacillus subtilis [TaxId:1423]
    Gene: SPO0B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ixma_
  • Chain 'B':
    Compound: protein (sporulation response regulatory protein)
    Species: Bacillus subtilis [TaxId:1423]
    Gene: SPO0B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ixmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ixmA (A:)
    mkdvsknqeenisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvi
    dakhesklsnlktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhl
    fdqavsresenhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfei
    tsheclieigld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ixmA (A:)
    sdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnlk
    tphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresenh
    ltvslqtdhpdrqlilyldfhgafadpsafdimrfeitsheclieigl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ixmB (B:)
    mkdvsknqeenisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvi
    dakhesklsnlktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhl
    fdqavsresenhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfei
    tsheclieigld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ixmB (B:)
    nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
    lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
    nhltvslqtdhpdrqlilyldfhgafadpsafddivdimrfeitsheclieigld