PDB entry 1ixm

View 1ixm on RCSB PDB site
Description: crystal structure of spoob from bacillus subtilis
Deposited on 1998-11-06, released 1998-11-25
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ixma_
  • Chain 'B':
    Domains in SCOP 1.55: d1ixmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ixmA (A:)
    sdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnlk
    tphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresenh
    ltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ixmA (A:)
    sdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnlk
    tphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresenh
    ltvslqtdhpdrqlilyldfhgafadpsafdimrfeitsheclieigl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ixmB (B:)
    nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
    lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
    nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ixmB (B:)
    nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
    lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
    nhltvslqtdhpdrqlilyldfhgafadpsafddivdimrfeitsheclieigld