PDB entry 1ixd

View 1ixd on RCSB PDB site
Description: Solution structure of the CAP-GLY domain from human cylindromatosis tomour-suppressor CYLD
Class: antitumor protein
Keywords: Structural genomics, Tumour suppressor, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ANTITUMOR PROTEIN
Deposited on 2002-06-19, released 2002-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cylindromatosis tumour-suppressor CYLD
    Species: Homo sapiens [TaxId:9606]
    Gene: fh04363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NQC7 (7-97)
      • cloning artifact (0-6)
      • cloning artifact (98-103)
    Domains in SCOPe 2.07: d1ixda1, d1ixda2, d1ixda3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixdA (A:)
    gssgssglamppgnshglevgslaevkenppfygvirwigqppglnevlagleledecag
    ctdgtfrgtryftcalkkalfvklkscrpdsrfaslqpsgpssg