PDB entry 1ixb

View 1ixb on RCSB PDB site
Description: crystal structure of the e. coli manganese(II) superoxide dismutase mutant y174f at 0.90 angstroms resolution.
Class: oxidoreductase
Keywords: manganese(II) superoxide dismutase, y174f mutant, hydrogen bond reactivity, ultrahigh resolution, oxidoreductase
Deposited on 2002-06-18, released 2002-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 0.9 Å
R-factor: 0.111
AEROSPACI score: 1.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00448 (0-204)
      • engineered (173)
    Domains in SCOPe 2.07: d1ixba1, d1ixba2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00448 (0-204)
      • engineered (173)
    Domains in SCOPe 2.07: d1ixbb1, d1ixbb2
  • Heterogens: MH2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixbA (A:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayflkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixbB (B:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayflkfqnr
    rpdyikefwnvvnwdeaaarfaakk