PDB entry 1ixa

View 1ixa on RCSB PDB site
Description: the three-dimensional structure of the first egf-like module of human factor ix: comparison with egf and tgf-a
Class: human factor ix
Keywords: human factor ix
Deposited on 1991-11-14, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: egf-like module of human factor ix
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ixaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ixaA (A:)
vdgdqcesnpclnggsckddinsyecwcpfgfegkncel