PDB entry 1ixa

View 1ixa on RCSB PDB site
Description: the three-dimensional structure of the first egf-like module of human factor ix: comparison with egf and tgf-a
Class: human factor ix
Keywords: human factor ix
Deposited on 1991-11-14, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: egf-like module of human factor ix
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00740 (0-38)
  Domains in SCOPe 2.08: d1ixaa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ixaA (A:)
  vdgdqcesnpclnggsckddinsyecwcpfgfegkncel