PDB entry 1ix9

View 1ix9 on RCSB PDB site
Description: Crystal Structure of the E. coli Manganase(III) superoxide dismutase mutant Y174F at 0.90 angstroms resolution.
Class: oxidoreductase
Keywords: manganese superoxide dismutase, y174f mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase
Deposited on 2002-06-17, released 2002-12-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.9 Å
R-factor: 0.107
AEROSPACI score: 1.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00448 (0-204)
      • engineered (173)
    Domains in SCOPe 2.06: d1ix9a1, d1ix9a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00448 (0-204)
      • engineered (173)
    Domains in SCOPe 2.06: d1ix9b1, d1ix9b2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ix9A (A:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayflkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ix9B (B:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayflkfqnr
    rpdyikefwnvvnwdeaaarfaakk