PDB entry 1ix0

View 1ix0 on RCSB PDB site
Description: I59A-3SS human lysozyme
Class: hydrolase
Keywords: stability, water
Deposited on 2002-06-06, released 2003-07-22
The last revision prior to the SCOP 1.75 freeze date was dated 2003-07-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (58)
      • engineered (76)
      • engineered (94)
    Domains in SCOP 1.75: d1ix0a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ix0A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqan
    srywcndgktpgavnaahlscsallqdniadavaaakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv