PDB entry 1iwz

View 1iwz on RCSB PDB site
Description:
Deposited on 2002-06-03, released 2002-09-04
The last revision prior to the SCOP 1.63 freeze date was dated 2002-09-04, with a file datestamp of 2002-09-04.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.204
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1iwza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwzA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv