PDB entry 1iwy

View 1iwy on RCSB PDB site
Description: Crystal Structure Analysis of Human lysozyme at 170K.
Class: hydrolase
Keywords: o-glycosyl, glycosydase, hydrolase
Deposited on 2002-06-03, released 2002-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.194
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwya_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwyA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv