PDB entry 1iwv

View 1iwv on RCSB PDB site
Description: Crystal Structure Analysis of Human lysozyme at 147K.
Class: hydrolase
Keywords: o-glycosyl, glycosydase
Deposited on 2002-06-03, released 2002-09-04
The last revision prior to the SCOP 1.75 freeze date was dated 2002-09-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.16
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1iwva_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwvA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv