PDB entry 1iwh

View 1iwh on RCSB PDB site
Description: Crystal Structure of Horse Carbonmonoxyhemoglobin-Bezafibrate Complex at 1.55A Resolution: A Novel Allosteric Binding Site in R-State Hemoglobin
Class: oxygen storage/transport
Keywords: Horse, Hemoglobin, Ligand-bezafibrate, Carbonmonoxyhemoglobin, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2002-05-15, released 2002-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.174
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iwha_
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iwhb_
  • Heterogens: HEM, CMO, PEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwhA (A:)
    vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
    kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwhB (B:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
    dftpelqasyqkvvagvanalahkyh