PDB entry 1iwb

View 1iwb on RCSB PDB site
Description: Crystal structure of diol dehydratase
Class: lyase
Keywords: beta-alpha-barrels, LYASE
Deposited on 2002-05-01, released 2003-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.181
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DIOL DEHYDRATASE alpha chain
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwba_
  • Chain 'B':
    Compound: DIOL DEHYDRATASE beta chain
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwbb_
  • Chain 'E':
    Compound: DIOL DEHYDRATASE beta chain
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwbe_
  • Chain 'G':
    Compound: DIOL DEHYDRATASE gamma chain
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwbg_
  • Chain 'L':
    Compound: DIOL DEHYDRATASE alpha chain
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwbl_
  • Chain 'M':
    Compound: DIOL DEHYDRATASE gamma chain
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwbm_
  • Heterogens: K, B12, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iwbA (A:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpneid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwbA (A:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iwbB (B:)
    meinekllrqiiedvlsemkgsdkpvsfnapaasaapqatppagdgfltevgearqgtqq
    deviiavgpafglaqtvnivgiphksilreviagieeegikarvircfkssdvafvaveg
    nrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltletyrqigknaaryakres
    pqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwbB (B:)
    gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
    rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
    rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1iwbE (E:)
    meinekllrqiiedvlsemkgsdkpvsfnapaasaapqatppagdgfltevgearqgtqq
    deviiavgpafglaqtvnivgiphksilreviagieeegikarvircfkssdvafvaveg
    nrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltletyrqigknaaryakres
    pqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwbE (E:)
    gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
    rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
    rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1iwbG (G:)
    mntdaiesmvrdvlsrmnslqgeapaaapaaggasrsarvsdyplankhpewvktatnkt
    lddftlenvlsnkvtaqdmritpetlrlqasiakdagrdrlamnferaaeltavpddril
    eiynalrpyrstkeellaiaddlesryqakicaafvreaatlyverkklkgdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwbG (G:)
    sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
    grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
    reaatlyverkklkgdd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1iwbL (L:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpneid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwbL (L:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1iwbM (M:)
    mntdaiesmvrdvlsrmnslqgeapaaapaaggasrsarvsdyplankhpewvktatnkt
    lddftlenvlsnkvtaqdmritpetlrlqasiakdagrdrlamnferaaeltavpddril
    eiynalrpyrstkeellaiaddlesryqakicaafvreaatlyverkklkgdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwbM (M:)
    sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
    grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
    reaatlyverkklkgdd