PDB entry 1iw8

View 1iw8 on RCSB PDB site
Description: Crystal Structure of a mutant of acid phosphatase from Escherichia blattae (G74D/I153T)
Class: hydrolase
Keywords: all alpha, hydrolase
Deposited on 2002-04-22, released 2002-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acid phosphatase
    Species: Escherichia blattae [TaxId:563]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S1A6
      • engineered (73)
      • engineered (152)
    Domains in SCOPe 2.07: d1iw8a_
  • Chain 'B':
    Compound: acid phosphatase
    Species: Escherichia blattae [TaxId:563]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S1A6
      • engineered (73)
      • engineered (152)
    Domains in SCOPe 2.07: d1iw8b_
  • Chain 'C':
    Compound: acid phosphatase
    Species: Escherichia blattae [TaxId:563]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S1A6
      • engineered (73)
      • engineered (152)
    Domains in SCOPe 2.07: d1iw8c_
  • Chain 'D':
    Compound: acid phosphatase
    Species: Escherichia blattae [TaxId:563]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S1A6
      • engineered (73)
      • engineered (152)
    Domains in SCOPe 2.07: d1iw8d_
  • Chain 'E':
    Compound: acid phosphatase
    Species: Escherichia blattae [TaxId:563]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S1A6
      • engineered (73)
      • engineered (152)
    Domains in SCOPe 2.07: d1iw8e_
  • Chain 'F':
    Compound: acid phosphatase
    Species: Escherichia blattae [TaxId:563]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S1A6
      • engineered (73)
      • engineered (152)
    Domains in SCOPe 2.07: d1iw8f_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iw8A (A:)
    lalvatgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrnter
    gklaaedanlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymr
    irpfafygvstcntteqdklskngsypsghtstgwatalvlaeinpqrqneilkrgyelg
    qsrvicgyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw8A (A:)
    gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae
    danlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf
    ygvstcnklskngsypsghtstgwatalvlaeinpqrqneilkrgyelgqsrvicgyhwq
    sdvdaarvvgsavvatlhtnpafqqqlqkakaefaqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iw8B (B:)
    lalvatgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrnter
    gklaaedanlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymr
    irpfafygvstcntteqdklskngsypsghtstgwatalvlaeinpqrqneilkrgyelg
    qsrvicgyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw8B (B:)
    tgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaa
    edanlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfa
    fygvstcntskngsypsghtstgwatalvlaeinpqrqneilkrgyelgqsrvicgyhwq
    sdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iw8C (C:)
    lalvatgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrnter
    gklaaedanlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymr
    irpfafygvstcntteqdklskngsypsghtstgwatalvlaeinpqrqneilkrgyelg
    qsrvicgyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw8C (C:)
    tgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaa
    edanlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfa
    fygvstcntskngsypsghtstgwatalvlaeinpqrqneilkrgyelgqsrvicgyhwq
    sdvdaarvvgsavvatlhtnpafqqqlqkakaefaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1iw8D (D:)
    lalvatgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrnter
    gklaaedanlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymr
    irpfafygvstcntteqdklskngsypsghtstgwatalvlaeinpqrqneilkrgyelg
    qsrvicgyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw8D (D:)
    gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae
    danlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf
    ygvstcnskngsypsghtstgwatalvlaeinpqrqneilkrgyelgqsrvicgyhwqsd
    vdaarvvgsavvatlhtnpafqqqlqkakaefaqh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1iw8E (E:)
    lalvatgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrnter
    gklaaedanlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymr
    irpfafygvstcntteqdklskngsypsghtstgwatalvlaeinpqrqneilkrgyelg
    qsrvicgyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw8E (E:)
    gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae
    danlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf
    ygvstcnskngsypsghtstgwatalvlaeinpqrqneilkrgyelgqsrvicgyhwqsd
    vdaarvvgsavvatlhtnpafqqqlqkakaefaq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1iw8F (F:)
    lalvatgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrnter
    gklaaedanlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymr
    irpfafygvstcntteqdklskngsypsghtstgwatalvlaeinpqrqneilkrgyelg
    qsrvicgyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw8F (F:)
    tgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaa
    edanlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfa
    fygvstcntskngsypsghtstgwatalvlaeinpqrqneilkrgyelgqsrvicgyhwq
    sdvdaarvvgsavvatlhtnpafqqqlqkakaefaqh