PDB entry 1iw5

View 1iw5 on RCSB PDB site
Description: Solution structure of the BolA-like protein from Mus musculus
Class: structural genomics, unknown function
Keywords: stationary phase morphogene, stress-induced morphogene, structural genomics
Deposited on 2002-04-19, released 2002-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2004-02-10, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BolA-like protein
    Species: MUS MUSCULUS
    Domains in SCOPe 2.06: d1iw5a1, d1iw5a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iw5A (A:)
    mkgsshhhhhhssgaslvprgsegaatmelsadylreklrqdleaehvevedttlnrcat
    sfrvlvvsakfegkpllqrhrlvneclaeelphihafeqktltpeqwtrqrre