PDB entry 1ivz

View 1ivz on RCSB PDB site
Description: Solution structure of the SEA domain from murine hypothetical protein homologous to human mucin 16
Class: structural genomics, unknown function
Keywords: structural genomics, SEA domain, mucin 16, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2002-04-02, released 2002-10-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein 1110008I14RIK
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9D1H1 (7-125)
    • cloning artifact (0-6)
    • cloning artifact (126-131)
  Domains in SCOPe 2.05: d1ivza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ivzA (A:)
  gssgssgssssqhfnlnftitnlpysqdiaqpsttkyqqtkrsienalnqlfrnssiksy
  fsdcqvlafrsvsnnnnhtgvdslcnfsplarrvdrvaiyeeflrmthngtqllnftldr
  ksvfvdsgpssg