PDB entry 1ivy

View 1ivy on RCSB PDB site
Description: physiological dimer hpp precursor
Deposited on 1996-06-12, released 1997-04-21
The last revision prior to the SCOP 1.57 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ivya_
  • Chain 'B':
    Domains in SCOP 1.57: d1ivyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ivyA (A:)
    apdqdeiqrlpglakqpsfrqysgylkssgskhlhywfvesqkdpenspvvlwlnggpgc
    ssldglltehgpflvqpdgvtleynpyswnlianvlylespagvgfsysddkfyatndte
    vaqsnfealqdffrlfpeyknnklfltgesyagiyiptlavlvmqdpsmnlqglavgngl
    ssyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlqevarivg
    nsglniynlyapcaggvpshfryekdtvvvqdlgniftrlplkrmwhqallrsgdkvrmd
    ppctnttaastylnnpyvrkalnipeqlpqwdmcnflvnlqyrrlyrsmnsqylkllssq
    kyqillyngdvdmacnfmgdewfvdslnqkmevqrrpwlvkygdsgeqiagfvkefshia
    fltikgaghmvptdkplaaftmfsrflnkqpy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ivyB (B:)
    apdqdeiqrlpglakqpsfrqysgylkssgskhlhywfvesqkdpenspvvlwlnggpgc
    ssldglltehgpflvqpdgvtleynpyswnlianvlylespagvgfsysddkfyatndte
    vaqsnfealqdffrlfpeyknnklfltgesyagiyiptlavlvmqdpsmnlqglavgngl
    ssyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlqevarivg
    nsglniynlyapcaggvpshfryekdtvvvqdlgniftrlplkrmwhqallrsgdkvrmd
    ppctnttaastylnnpyvrkalnipeqlpqwdmcnflvnlqyrrlyrsmnsqylkllssq
    kyqillyngdvdmacnfmgdewfvdslnqkmevqrrpwlvkygdsgeqiagfvkefshia
    fltikgaghmvptdkplaaftmfsrflnkqpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ivyB (B:)
    apdqdeiqrlpglakqpsfrqysgylkssgskhlhywfvesqkdpenspvvlwlnggpgc
    ssldglltehgpflvqpdgvtleynpyswnlianvlylespagvgfsysddkfyatndte
    vaqsnfealqdffrlfpeyknnklfltgesyagiyiptlavlvmqdpsmnlqglavgngl
    ssyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlqevarivg
    nsglniynlyapcaggvpfryekdtvvvqdlgniftrlplkrmwhqallrsgdkvrmdpp
    ctnttaastylnnpyvrkalnipeqlpqwdmcnflvnlqyrrlyrsmnsqylkllssqky
    qillyngdvdmacnfmgdewfvdslnqkmevqrrpwlvkygdsgeqiagfvkefshiafl
    tikgaghmvptdkplaaftmfsrflnkqpy