PDB entry 1ivv

View 1ivv on RCSB PDB site
Description: Crystal structure of copper amine oxidase from Arthrobacter globiformis: Early intermediate in topaquinone biogenesis
Class: oxidoreductase
Keywords: Oxidoreductase, Amine oxidase, Biogenesis, TPQ, Freeze-trapp, Intermediate, Quinone cofactor, DAH
Deposited on 2002-03-29, released 2002-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amine oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46881
      • see remark 999 (381)
    Domains in SCOPe 2.06: d1ivva1, d1ivva2, d1ivva3
  • Chain 'B':
    Compound: amine oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46881
      • see remark 999 (381)
    Domains in SCOPe 2.06: d1ivvb1, d1ivvb2, d1ivvb3
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ivvA (A:)
    mtpstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrf
    rvfihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlk
    alaarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvd
    vvskevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiew
    ekwsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtg
    eylvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlws
    ginytrrnrrmvisffttignfdygfywylyldgtiefeakatgvvftsafpeggsdnis
    qlapglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltre
    seavreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkd
    lwvtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwp
    impvdtvgfklrpegffdrspvldvpanpsqsgshchg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ivvA (A:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignfdygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ivvB (B:)
    mtpstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrf
    rvfihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlk
    alaarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvd
    vvskevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiew
    ekwsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtg
    eylvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlws
    ginytrrnrrmvisffttignfdygfywylyldgtiefeakatgvvftsafpeggsdnis
    qlapglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltre
    seavreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkd
    lwvtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwp
    impvdtvgfklrpegffdrspvldvpanpsqsgshchg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ivvB (B:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignfdygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan