PDB entry 1ivt

View 1ivt on RCSB PDB site
Description: nmr structures of the c-terminal globular domain of human lamin a/c
Deposited on 2002-03-29, released 2002-08-21
The last revision prior to the SCOP 1.71 freeze date was dated 2002-08-21, with a file datestamp of 2002-08-21.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ivta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ivtA (A:)
ssfsqhartsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltyrfppkf
tlkagqvvtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsv
tv