PDB entry 1ivs

View 1ivs on RCSB PDB site
Description: crystal structure of thermus thermophilus valyl-tRNA synthetase complexed with tRNA(val) and valyl-adenylate analogue
Class: ligase/RNA
Keywords: Rossmann fold, helix bundle, coiled coil, beta barrel, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LIGASE/RNA COMPLEX
Deposited on 2002-03-29, released 2003-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.248
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: valyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: valS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ivsa1, d1ivsa2, d1ivsa3, d1ivsa4
  • Chain 'B':
    Compound: valyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: valS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ivsb1, d1ivsb2, d1ivsb3, d1ivsb4
  • Chain 'C':
    Compound: tRNA (Val)
  • Chain 'D':
    Compound: tRNA (Val)
  • Heterogens: VAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ivsA (A:)
    mdlpkaydpksvepkwaekwaknpfvanpksgkppfvifmpppnvtgslhmghaldnslq
    dalirykrmrgfeavwlpgtdhagiatqvvverlllkegktrhdlgrekflervwqwkee
    sggtilkqlkrlgasadwsreaftmdekrsravryafsryyheglayraprlvnwcprce
    ttlsdleveteptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllg
    kraripltevwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrm
    egervpealrgldrfearrkavelfreaghlvkeedytialatcsrcgtpieyaifpqww
    lrmrplaeevlkglrrgdiafvperwkkvnmdwlenvkdwnisrqlwwghqipawycedc
    qavnvprperyledptsceacgsprlkrdedvfdtwfssalwplstlgwpeetedlkafy
    pgdvlvtgydilflwvsrmevsgyhfmgerpfktvllhglvldekgqkmskskgnvidpl
    emverygadalrfaliylatggqdirldlrwlemarnfanklynaarfvllsregfqake
    dtptladrfmrsrlsrgveeitalyealdlaqaarevyelvwsefcdwyleaakpalkag
    nahtlrtleevlavllkllhpmmpfltselyqaltgkeelaleawpepggrdeeaerafe
    alkqavtavralkaeaglppaqevrvylegetapveenlevfrflsradllperpakalv
    kamprvtarmpleglldveewrrrqekrlkellalaersqrklaspgfrekapkevveae
    earlkenleqaerirealsqig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ivsB (B:)
    mdlpkaydpksvepkwaekwaknpfvanpksgkppfvifmpppnvtgslhmghaldnslq
    dalirykrmrgfeavwlpgtdhagiatqvvverlllkegktrhdlgrekflervwqwkee
    sggtilkqlkrlgasadwsreaftmdekrsravryafsryyheglayraprlvnwcprce
    ttlsdleveteptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllg
    kraripltevwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrm
    egervpealrgldrfearrkavelfreaghlvkeedytialatcsrcgtpieyaifpqww
    lrmrplaeevlkglrrgdiafvperwkkvnmdwlenvkdwnisrqlwwghqipawycedc
    qavnvprperyledptsceacgsprlkrdedvfdtwfssalwplstlgwpeetedlkafy
    pgdvlvtgydilflwvsrmevsgyhfmgerpfktvllhglvldekgqkmskskgnvidpl
    emverygadalrfaliylatggqdirldlrwlemarnfanklynaarfvllsregfqake
    dtptladrfmrsrlsrgveeitalyealdlaqaarevyelvwsefcdwyleaakpalkag
    nahtlrtleevlavllkllhpmmpfltselyqaltgkeelaleawpepggrdeeaerafe
    alkqavtavralkaeaglppaqevrvylegetapveenlevfrflsradllperpakalv
    kamprvtarmpleglldveewrrrqekrlkellalaersqrklaspgfrekapkevveae
    earlkenleqaerirealsqig
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.