PDB entry 1ivq

View 1ivq on RCSB PDB site
Description: the crystallographic structure of the protease from human immunodeficiency virus type 2 with two synthetic peptidic transition state analog inhibitors
Deposited on 1993-03-18, released 1993-07-15
The last revision prior to the SCOP 1.65 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.186
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ivqa_
  • Chain 'B':
    Domains in SCOP 1.65: d1ivqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ivqA (A:)
    pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
    nveievlnkkvratimtgdtpinifgrniltalgmslnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ivqB (B:)
    pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
    nveievlnkkvratimtgdtpinifgrniltalgmslnl