PDB entry 1ivo

View 1ivo on RCSB PDB site
Description: Crystal Structure of the Complex of Human Epidermal Growth Factor and Receptor Extracellular Domains.
Class: transferase/signaling protein
Keywords: Transmembrane, Glycoprotein, Receptor, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE-SIGNALING PROTEIN COMPLEX
Deposited on 2002-03-28, released 2002-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.255
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ivoa1, d1ivoa2, d1ivoa3, d1ivoa4, d1ivoa5
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ivob1, d1ivob2, d1ivob3, d1ivob4, d1ivob5
  • Chain 'C':
    Compound: epidermal growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ivoc_
  • Chain 'D':
    Compound: epidermal growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ivod_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ivoA (A:)
    leekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqe
    vagyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeil
    hgavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngscwgage
    encqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpresdclvcrkfrdeatckdtc
    pplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgscvracgadsyemeedgvr
    kckkcegpcrkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsftht
    ppldpqeldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvsln
    itslglrslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
    vchalcspegcwgpeprdcvscrnvsrgrecvdkcnllegeprefvenseciqchpeclp
    qamnitctgrgpdnciqcahyidgphcvktcpagvmgenntlvwkyadaghvchlchpnc
    tygctgpglegcptngpkipsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ivoA (A:)
    eekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqev
    agyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeilh
    gavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngscwgagee
    ncqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpresdclvcrkfrdeatckdtcp
    plmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgscvracgadsyemeedgvrk
    ckkcegpcrkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtp
    pldpqeldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslni
    tslglrslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqv
    chalcspegcwgpeprdcvscrnvsrgrecv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ivoB (B:)
    leekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqe
    vagyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeil
    hgavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngscwgage
    encqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpresdclvcrkfrdeatckdtc
    pplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgscvracgadsyemeedgvr
    kckkcegpcrkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsftht
    ppldpqeldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvsln
    itslglrslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
    vchalcspegcwgpeprdcvscrnvsrgrecvdkcnllegeprefvenseciqchpeclp
    qamnitctgrgpdnciqcahyidgphcvktcpagvmgenntlvwkyadaghvchlchpnc
    tygctgpglegcptngpkipsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ivoB (B:)
    ekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqeva
    gyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeilhg
    avrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngscwgageen
    cqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpresdclvcrkfrdeatckdtcpp
    lmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgscvracgadsyemeedgvrkc
    kkcegpcrkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtpp
    ldpqeldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnit
    slglrslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvc
    halcspegcwgpeprdcvscrnvsrgrecv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ivoC (C:)
    nsdsecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwelr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ivoC (C:)
    ecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ivoD (D:)
    nsdsecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwelr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ivoD (D:)
    ecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwe