PDB entry 1ivn

View 1ivn on RCSB PDB site
Description: E.coli Thioesterase I/Protease I/Lysophospholiase L1
Class: hydrolase
Keywords: Hydrolase, Protease
Deposited on 2002-03-27, released 2003-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.229
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioesterase I
    Species: Escherichia coli [TaxId:562]
    Gene: tesA/apeA/pldC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ivna_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ivnA (A:)
    adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
    hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrrynea
    fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvnh
    dslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ivnA (A:)
    adtllilgdslsagyrmsasaawpallndkwsktsvvnasisgdtsqqglarlpallkqh
    qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrryneaf
    saiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvnh