PDB entry 1ivm

View 1ivm on RCSB PDB site
Description: Solution structure of mouse lysozyme M
Class: hydrolase
Keywords: Hydrolase, Glycosidase
Deposited on 2002-03-27, released 2002-05-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme M
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ivma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ivmA (A:)
    kvyercefartlkrngmagyygvsladwvclaqhesnyntratnynrgdqstdygifqin
    srywcndgktpravnacgincsallqdditaaiqcakrvvrdpqgirawvawrahcqnrd
    lsqyirncgv