PDB entry 1ivm

View 1ivm on RCSB PDB site
Description:
Deposited on 2002-03-27, released 2002-05-08
The last revision prior to the SCOP 1.63 freeze date was dated 2002-05-08, with a file datestamp of 2002-05-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ivma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ivmA (A:)
    kvyercefartlkrngmagyygvsladwvclaqhesnyntratnynrgdqstdygifqin
    srywcndgktpravnacgincsallqdditaaiqcakrvvrdpqgirawvawrahcqnrd
    lsqyirncgv