PDB entry 1ivl

View 1ivl on RCSB PDB site
Description: the de novo design of an antibody combining site: crystallographic analysis of the vl domain confirms the structural model
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1994-05-04, released 1994-08-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.175
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg-kappa m29b fv (light chain)
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • GB AAA38741 (0-106)
      • conflict (2)
      • conflict (20)
      • conflict (31)
      • conflict (33)
      • conflict (82-84)
      • conflict (90-92)
      • conflict (95)
    Domains in SCOPe 2.03: d1ivla_
  • Chain 'B':
    Compound: igg-kappa m29b fv (light chain)
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • GB AAA38741 (0-106)
      • conflict (2)
      • conflict (20)
      • conflict (31)
      • conflict (33)
      • conflict (82-84)
      • conflict (90-92)
      • conflict (95)
    Domains in SCOPe 2.03: d1ivlb_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ivlA (A:)
    dieltqspatlsvtpgnsvsiscrasqsignrlfwyqqkshesprllikyasqsisgips
    rfsgsgsgtdftlsinsvetedlavyfcqqvsewpftfgggtkleik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ivlB (B:)
    dieltqspatlsvtpgnsvsiscrasqsignrlfwyqqkshesprllikyasqsisgips
    rfsgsgsgtdftlsinsvetedlavyfcqqvsewpftfgggtkleik