PDB entry 1ivl

View 1ivl on RCSB PDB site
Description: the de novo design of an antibody combining site: crystallographic analysis of the vl domain confirms the structural model
Deposited on 1994-05-04, released 1994-08-31
The last revision prior to the SCOP 1.63 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.17 Å
R-factor: 0.175
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ivla_
  • Chain 'B':
    Domains in SCOP 1.63: d1ivlb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ivlA (A:)
dieltqspatlsvtpgnsvsiscrasqsignrlfwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedlavyfcqqvsewpftfgggtkleik

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ivlB (B:)
dieltqspatlsvtpgnsvsiscrasqsignrlfwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedlavyfcqqvsewpftfgggtkleik