PDB entry 1iv9

View 1iv9 on RCSB PDB site
Description: Crystal Structure of Single Chain Monellin
Class: plant protein
Keywords: alpha+beta, plant protein
Deposited on 2002-03-15, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iv9a_
  • Chain 'B':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iv9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iv9A (A:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeengfreikgyey
    qlyvyasdklfradisedyktrgrkllrfngpvppp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iv9B (B:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeengfreikgyey
    qlyvyasdklfradisedyktrgrkllrfngpvppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iv9B (B:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyereikgyeyqlyv
    yasdklfradisedyktrgrkllrfngpvppp