PDB entry 1iv6

View 1iv6 on RCSB PDB site
Description: solution structure of the dna complex of human trf1
Deposited on 2002-03-14, released 2002-04-17
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-17, with a file datestamp of 2002-04-17.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1iv6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iv6A (A:)
    rkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklklis