PDB entry 1iv6

View 1iv6 on RCSB PDB site
Description: Solution Structure of the DNA Complex of Human TRF1
Class: DNA binding protein/DNA
Keywords: TELOMERES, Protein-DNA complex, MYB DOMAIN, Helix-turn-helix, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2002-03-14, released 2002-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: telomeric repeat binding factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1iv6a_
  • Chain 'B':
    Compound: 5'-d(*gp*tp*tp*ap*gp*gp*gp*tp*tp*ap*gp*gp*g)-3'
  • Chain 'C':
    Compound: 5'-d(*cp*cp*cp*tp*ap*ap*cp*cp*cp*tp*ap*ap*c)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1iv6A (A:)
mtpekhrarkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkk
lklissdsed

    Sequence, based on observed residues (ATOM records): (download) 
    >1iv6A (A:)
rkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklklis

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.