PDB entry 1iuy

View 1iuy on RCSB PDB site
Description: Solution structure of the cullin-3 homologue
Class: structural genomics, unknown function
Keywords: winged helix, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2002-03-08, released 2003-10-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-10-07, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cullin-3 homologue
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLV5 (1-91)
      • initiating met (0)
    Domains in SCOP 1.73: d1iuya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iuyA (A:)
    maakqgesdperketrqkvdddrkheieaaivrimksrkkmqhnvlvaevtqqlkarflp
    spvvikkriegliereylartpedrkvytyva