PDB entry 1iuy

View 1iuy on RCSB PDB site
Description: solution structure of the cullin-3 homologue
Deposited on 2002-03-08, released 2003-10-07
The last revision prior to the SCOP 1.71 freeze date was dated 2003-10-07, with a file datestamp of 2003-10-07.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1iuya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iuyA (A:)
    maakqgesdperketrqkvdddrkheieaaivrimksrkkmqhnvlvaevtqqlkarflp
    spvvikkriegliereylartpedrkvytyva