PDB entry 1iur

View 1iur on RCSB PDB site
Description: dnaj domain of human kiaa0730 protein
Deposited on 2002-03-07, released 2003-10-07
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-07, with a file datestamp of 2003-10-07.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1iura_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iurA (A:)
  mhhhhhhlvprgsilkevtsvveqawklpeserkkiirrlylkwhpdknpenhdianevf
  khlqneinrlekqafldqnadrasrrtf