PDB entry 1iur

View 1iur on RCSB PDB site
Description: DnaJ domain of human KIAA0730 protein
Class: structural genomics, unknown function
Keywords: DnaJ like domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, UNKNOWN FUNCTION
Deposited on 2002-03-07, released 2003-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA0730 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: AB018273
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZJ4 (13-87)
      • expression tag (0-12)
    Domains in SCOPe 2.08: d1iura1, d1iura2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iurA (A:)
mhhhhhhlvprgsilkevtsvveqawklpeserkkiirrlylkwhpdknpenhdianevf
khlqneinrlekqafldqnadrasrrtf