PDB entry 1iuq

View 1iuq on RCSB PDB site
Description: The 1.55 A Crystal Structure of Glycerol-3-Phosphate Acyltransferase
Class: transferase
Keywords: open twisted alpha/beta, four helix bundle, transferase
Deposited on 2002-03-06, released 2003-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.202
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol-3-phosphate acyltransferase
    Species: Cucurbita moschata [TaxId:3662]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10349 (2-366)
      • cloning artifact (0-1)
      • modified residue (36)
      • modified residue (63)
      • modified residue (193)
      • modified residue (214)
      • modified residue (256)
      • modified residue (280)
      • modified residue (338)
    Domains in SCOPe 2.06: d1iuqa1, d1iuqa2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iuqA (A:)
    ashsrkfldvrseeellscikketeagklppnvaagmeelyqnyrnaviesgnpkadeiv
    lsnmtvaldrilldvedpfvfsshhkairepfdyyifgqnyirplidfgnsfvgnlslfk
    dieeklqqghnvvlisnhqteadpaiislllektnpyiaentifvagdrvladplckpfs
    igrnlicvyskkhmfdipeltetkrkantrslkemalllrggsqliwiapsggrdrpdps
    tgewypapfdassvdnmrrliqhsdvpghlfplallchdimpppsqveieigekrviafn
    gaglsvapeisfeeiaathknpeevreayskalfdsvamqynvlktaisgkqglgastad
    vslsqpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iuqA (A:)
    ashsrkfldvrseeellscikketeagklppnvaagmeelyqnyrnaviesgnpkadeiv
    lsnmtvaldrilldvedpfvfsshhkairepfdyyifgqnyirplidfgnsfvgnlslfk
    dieeklqqghnvvlisnhqteadpaiislllektnpyiaentifvagdrvladplckpfs
    igrnlicvyskkhmfdipeltetkrkantrslkemalllrggsqliwiapsggrdrpdps
    tgewypapfdassvdnmrrliqhsdvpghlfplallchdimppprviafngaglsvapei
    sfeeiaathknpeevreayskalfdsvamqynvlktaisgkqglgastadvslsqpw