SCOPe 2.04: Structural Classification of Proteins

PDB entry 1iul

View 1iul on RCSB PDB site
Description: The structure of cell-free ID.343 from Thermus thermophilus
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2002-03-05, released 2003-07-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: hypothetical protein TT1466
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GHJ5 (0-End)
Domains in SCOPe 2.04: d1iula_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1iulA (A:)
mndqelraylsqaktiavlgahkdpsrpahyvprylreqgyrvlpvnprfqgeelfgeea
vaslldlkepvdildvfrppsalmdhlpevlalrpglvwlqsgirhpefekalkeagipv
vadrclmvehkrlfrgplpl

Sequence, based on observed residues (ATOM records): (download)

>1iulA (A:)
mndqelraylsqaktiavlgahkdpsrpahyvprylreqgyrvlpvnprfqgeelfgeea
vaslldlkepvdildvfrppsalmdhlpevlalrpglvwlqsgirhpefekalkeagipv
vadrclmvehkrlf