PDB entry 1iuj

View 1iuj on RCSB PDB site
Description: The structure of TT1380 protein from thermus thermophilus
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2002-03-05, released 2003-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.235
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TT1380
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iuja_
  • Chain 'B':
    Compound: hypothetical protein TT1380
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iujb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iujA (A:)
    mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlwesee
    afrawtespafkegharsgtlpkeaflgpnrleafevvldsegrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iujA (A:)
    mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlwesee
    afrawtespafkegharsgtlpkeaflgpnrleafevvldse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iujB (B:)
    mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlwesee
    afrawtespafkegharsgtlpkeaflgpnrleafevvldsegrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iujB (B:)
    mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlwesee
    afrawtespafkegharsgtlpkeaflgpnrleafevvldseg