PDB entry 1iuf

View 1iuf on RCSB PDB site
Description: LOW RESOLUTION SOLUTION STRUCTURE OF THE TWO DNA-BINDING DOMAINS IN Schizosaccharomyces pombe ABP1 PROTEIN
Class: DNA binding protein
Keywords: centromere, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN
Deposited on 2002-03-04, released 2002-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: centromere abp1 protein
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49777 (3-143)
      • cloning artifact (0-2)
    Domains in SCOPe 2.06: d1iufa1, d1iufa2, d1iufa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iufA (A:)
    gihmgkikrraitehekralrhyffqlqnrsgqqdliewfrekfgkdisqpsvsqilssk
    ysyldntvekpwdvkrnrppkyplleaalfewqvqqgddatlsgetikraaailwhkipe
    yqdqpvpnfsngwlegfrkrhilh